Design Engineer, Growth & Marketing
mid$180K – $300K
via Ashby
About this role
Perplexity is looking for a Design Engineer to help turn perplexity.com http://perplexity.com into a real growth engine, not a pile of one-off pages. You'll sit shoulder to shoulder with brand designers, PMMs, growth, and content teams, shipping product launch pages, campaign landing pages, and the components and tooling that let those teams move fast without lowering the bar.
This is a hands-on role for someone with real taste, sharp attention to detail, and the speed to turn a Figma file, a Slack thread, or a rough sketch into a polished, shipped page quickly.
Tech stack: React, TypeScript, Tailwind CSS, Sanity
WHAT YOU'LL DO
- Ship product launch pages and evergreen marketing pages for products like Comet, Computer, Deep Research, Search, and Hub.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: typescript, css, react, tailwind, figma…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in a specific location. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
typescriptcssreacttailwindfigmasketchslackteams