Software Engineer - Surfaces
San Francisco Bay Area or Remoteremotemid$120K – $290K
via Greenhouse
About this role
PlanetScale is growing rapidly and reinventing the database space. The PlanetScale platform offers both Postgres and Vitess clusters. Vitess, an open-source database clustering system for horizontal scaling of MySQL, enables businesses to efficiently handle large-scale data workloads — without sacrificing developer experience.
Our customers entrust us with what is often their most precious digital asset, their data, so the stakes couldn't be higher. We're looking for a Software Engineer to join our Surfaces team. The Surfaces team is responsible for all user-facing UIs, CLIs and APIs. We build and maintain the PlanetScale dashboard, APIs and billing systems every PlanetScale user relies on to launch and manage their databases.
What's the job to be done?…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: typescript, go, ruby, css, react…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is remote-eligible — we factor in your stated location and time-zone overlap.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
typescriptgorubycssreactnext.jsremixtailwindrailsrestfulpostgrespostgresqlmysqlplanetscaleawsgcpterraformteams
More at Planet Scale
- View →Enterprise Support EngineerRemote - NA, APAC, EMEA
- View →Software Engineer - InfrastructureSan Francisco Bay Area or Remote
- View →Software Engineer - Information SecuritySan Francisco Bay Area or Remote
- View →Developer EducatorSan Francisco and/or US Remote
- View →Solutions EngineerRemote - EMEA, Remote - NA
- View →Software Engineer - Sharded Postgres (Neki)San Francisco Bay Area or Remote
