Software Engineer I, MLOps (Python/Big Data)
PA - Pittsburgh (15219)onsitemid$75K – $150K
Posted today · via Workday
About this role
Position Overview At PNC, our people are our greatest differentiator and competitive advantage in the markets we serve. We are all united in delivering the best experience for our customers. We work together each day to foster an inclusive workplace culture where all of our employees feel respected, valued and have an opportunity to contribute to the company’s success. As a Software Engineer within PNC's Models Operationalization/MLOps organization, you will be based in Pittsburgh, PA or Cleveland, OH. PNC is an in-office company that fosters a supportive culture where employees can thrive and achieve balance. We encourage candidates to connect with their recruiter and hiring manager to understand workplace expectations and ensure the role aligns with their goals.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, aws, spark, pyspark, kafka…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in PA - Pittsburgh (15219). We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonawssparkpysparkkafkapandasteamsworkday
More at PNC Bank NA
- View →Fiduciary Advisor IIIOH - Cleveland (44114)
- View →Internal Audit Undergraduate InternPA - Pittsburgh (15222)
- View →Realty Services Undergraduate InternPA - Pittsburgh (15222)
- View →Realty Services Development Program Analyst/AssociatePA - Pittsburgh (15222)
- View →Corporate Finance & Accounting Undergraduate InternPA - Pittsburgh (15222)
- View →Independent Risk Management Development Program Analyst/AssociatePA - Pittsburgh (15222)
