P
PsuSoftware Engineer
Penn State University Parkonsitemid$92K – $175K
Posted today · via Workday
About this role
APPLICATION INSTRUCTIONS: CURRENT PENN STATE EMPLOYEE (faculty, staff, technical service, or student), please login to Workday to complete the internal application process . Please do not apply here, apply internally through Workday. CURRENT PENN STATE STUDENT (not employed previously at the university) and seeking employment with Penn State, please login to Workday to complete the student application process. Please do not apply here, apply internally through Workday. If you are NOT a current employee or student, please click “Apply” and complete the application process for external applicants . Approval of remote and hybrid work is not guaranteed regardless of work location. For additional information on remote work at Penn State, see Notice to Out of State Applicants .…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: javascript, python, java, rust, c++…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Penn State University Park. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javascriptpythonjavarustc++matlabbashsqlhtmlcssreacttailwindfastapiawskubernetesdockergitgitlabbitbucketjiraconfluenceteamsworkday
More at Psu
- View →Part-Time Teaching Assistant - MIS 431Penn State University Park
- View →Athletic Performance Coach, Track and FieldPenn State University Park
- View →Part-Time Research AssistantPenn State University Park
- View →SD-WAN Solutions Research Computing EngineerPenn State University Park
- View →Athletic Performance Coach, Baseball and Men's and Women's GolfPenn State University Park
- View →Women's Volleyball Analyst and Analytics CoordinatorPenn State University Park
