R
Raiffeisen UkraineІнформаційні технології

Analyst

Kyivonsitemid

Posted 1w ago · via Workable

About this role

Raiffeisen Bank is the largest Ukrainian bank with foreign capital. For more than 30 years, we have been creating and building the banking system of our country. Raiffeisen employs more than 5,000 employees, including one of the largest product IT teams, which includes 900+ specialists. Every day, we work side by side so that more than 2.5 million of our clients can receive quality service, use the bank’s products and services, and develop their business, because we are #TogetherWithUkraine.…

Read the full description on Raiffeisen Ukraine's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: python, java, go, kotlin, swift…

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Kyiv. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonjavagokotlinswiftsqlelasticsearchawskubernetesdockervaultgithub actionsprometheusopentelemetrysparkkafkaflinkairflowgithubteams

More at Raiffeisen Ukraine

See all open jobs at Raiffeisen Ukraine