reqspace
Start free trial →
S
Sanofi

Computational Science Lead

Torontoonsitesenior$158K – $208K

Posted today · via Workday

See if I'm a fit →Tailor my resume for this role →Apply on Workday ↗

About this role

Reference no. R2861855 Position Title: Computational Science Lead Department: Development AI Location: Toronto, ON About the Job Ready to push the limits of what’s possible? Join Sanofi in one of our corporate functions and you can play a vital part in the performance of our entire business while helping to make an impact on millions around the world. At Sanofi, we chase the miracles of science to improve people’s lives. Within Digital R&D, the Integrative Clinical Data (ICD) team builds AI-powered products that transform how clinical trials are designed, executed, and optimized. This role sits at the intersection of trial design, operational analytics, and AI-driven decision systems.…

Read the full description on Sanofi's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: python, r, snowflake, aws, pyspark…

2

Level fit

This role is senior-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Toronto. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonrsnowflakeawspysparkscikit-learnpytorchteams

More at Sanofi

See all open jobs at Sanofi →