Computational Science Lead
Torontoonsitesenior$158K – $208K
Posted today · via Workday
About this role
Reference no. R2861855 Position Title: Computational Science Lead Department: Development AI Location: Toronto, ON About the Job Ready to push the limits of what’s possible? Join Sanofi in one of our corporate functions and you can play a vital part in the performance of our entire business while helping to make an impact on millions around the world. At Sanofi, we chase the miracles of science to improve people’s lives. Within Digital R&D, the Integrative Clinical Data (ICD) team builds AI-powered products that transform how clinical trials are designed, executed, and optimized. This role sits at the intersection of trial design, operational analytics, and AI-driven decision systems.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, r, snowflake, aws, pyspark…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Toronto. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonrsnowflakeawspysparkscikit-learnpytorchteams
