Senior Data Scientist
Pune Cityonsitesenior
via Greenhouse
About this role
The Role
The Senior Data Scientist will lead the maturation of Securly's content classification system — building the ML infrastructure that determines, at scale, whether web content is appropriate for K-12 students, and establishing the rigorous evaluation framework that product and leadership teams depend on.
This is applied ML with direct student safety impact — not research. You will lead a significant uplift of Securly's classification models: refactoring binary models to proper multiclass classification, building labeled evaluation datasets, and producing standardized model cards with per-category precision, recall, F1, and confusion matrix analysis.
At L5, you are the technical leader of the data science function for content safety.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, html, aws, gcp, sagemaker…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Pune City. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonhtmlawsgcpsagemakerpandasscikit-learnpytorchtensorflowvertex aiteams
More at Securly
- View →Account Executive, Large/Enterprise – Join Our Remote Talent CommunityUnited States of America - Remote
- View →Customer Success Manager, Large/Enterprise School Districts – Join Our Remote Talent CommunityUnited States of America - Remote
- View →Customer Success Manager, Small & Mid-Market – Join Our Remote Talent CommunityUnited States of America - Remote
- View →Senior Software Engineer - Browser ExtensionsPune City, Maharashtra, India
- View →Account Executive, SMB – Join Our Remote Talent CommunityUnited States of America - Remote
- View →Technical Product Support - EdTechUnited States (Remote)
