Graduate Software Engineer
Kuala Lumpurhybridjunior
Posted yesterday · via Smartrecruiters
About this role
About About SEEK At SEEK, we serve a noble purpose: to help people live more productive and fulfilling working lives and to help organisations succeed. By joining us, you’ll be part of a multinational technology business that is far-reaching with a start-up working culture that focuses on a set of collaborative values and appreciates dynamic cultures. SEEK is a place where potential meets possibility – it’s where your career aspiration and our purpose can make great things happen. Why join us? Be part of a multinational tech company with strong core values to help us solve complex challenges while building a flexible, exciting career – one that could take you anywhere.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: typescript, react, graphql, aws, teams…
2
Level fit
This role is junior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Kuala Lumpur. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
typescriptreactgraphqlawsteamszoom
More at Seek
- View →Business Development ManagerCebu City, CEBU, Philippines
- View →Sr. Sales ExecutiveUptown Bonifacio, Taguig City, NATIONAL CAPITAL REGION (MANILA), Philippines
- View →Key Account ManagerUptown Bonifacio, Taguig City, NATIONAL CAPITAL REGION (MANILA), Philippines
- View →Senior Finance Business PartnerKuala Lumpur, Wilayah Persekutuan Kuala Lumpur, Malaysia
- View →Technology GraduateKuala Lumpur, Wilayah Persekutuan Kuala Lumpur, Malaysia
- View →Key Account ManagerCebu City, CEBU, Philippines
