Solutions Consultant
remotemid
via Ashby
About this role
ABOUT US
Singular is the leading marketing measurement platform trusted by 1,000+ global brands, including Apple, Microsoft, Uber, DoorDash, Nike, EA, DraftKings, and Robinhood. Ranked as the #1 MMP by G2 for 3 years in a row, Singular enables marketers to make smarter user acquisition decisions and analyze the impact of every ad dollar with full-funnel marketing analytics, advanced cross-device attribution (mobile, web, PC+Console), best-in-class ad fraud prevention, and automatic data exports directly into your BI tools. Singular is also revolutionizing campaign and creative analysis with recent integrations and partnerships with ChatGPT, Claude, and Gemini that deliver marketers with instant, AI-powered marketing insights – no dashboards or SQL needed.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: javascript, swift, sql, rest, gemini…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is remote-eligible — we factor in your stated location and time-zone overlap.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javascriptswiftsqlrestgeminiclaudeteams
