Solutions Consultant

remotemid

via Ashby

About this role

ABOUT US Singular is the leading marketing measurement platform trusted by 1,000+ global brands, including Apple, Microsoft, Uber, DoorDash, Nike, EA, DraftKings, and Robinhood. Ranked as the #1 MMP by G2 for 3 years in a row, Singular enables marketers to make smarter user acquisition decisions and analyze the impact of every ad dollar with full-funnel marketing analytics, advanced cross-device attribution (mobile, web, PC+Console), best-in-class ad fraud prevention, and automatic data exports directly into your BI tools. Singular is also revolutionizing campaign and creative analysis with recent integrations and partnerships with ChatGPT, Claude, and Gemini that deliver marketers with instant, AI-powered marketing insights – no dashboards or SQL needed.…

Read the full description on Singular's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: javascript, swift, sql, rest, gemini…

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is remote-eligible — we factor in your stated location and time-zone overlap.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascriptswiftsqlrestgeminiclaudeteams

More at Singular

See all open jobs at Singular