S
Sosi1Analyst

UI/UX Designer

Chantillyonsitemid

Posted 2w ago · via Smartrecruiters

About this role

About Founded in 1989 and headquartered in Reston, Virginia, SOSi is a private defense and government solutions business specializing in advanced technology systems and mission support. Its capabilities include data science, software development, network engineering, intelligence, surveillance, and reconnaissance (ISR), and logistics. *Position is contingent upon contract award* SOSi is seeking a UI/UX Designer. The UI/UX Designer will provide user interface/user experience to design, research, and development plans in support of the Sponsor's applications. The Designer will leverage expertise in UI/UX design principles, human-centered design, and user research to create intuitive and user-friendly digital experiences.…

Read the full description on Sosi1's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: javascript, html, css, figma, sketch…

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Chantilly. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascripthtmlcssfigmasketchinvisionteams

More at Sosi1

See all open jobs at Sosi1