Forward Deployed Engineer
San Franciscoonsitemid
via Greenhouse
About this role
As a Forward Deployment Engineer, you’ll help drive the growth of Speechmatics by working directly with customers, partners, and developer communities to demonstrate, integrate, customise, and deploy our Voice AI, fast.
You’ll operate at the intersection of engineering, product, and adoption. Part product evangelist, part hands-on builder, you’ll implement our Voice AI in demos, Proofs of Concept, pilots, and full-scale production environments. You’ll also engage with the wider developer ecosystem, building examples, running workshops, supporting integrations, and helping developers unlock the full potential of our APIs.
This is a deeply hands-on role.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: typescript, r, react, sveltekit, teams…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in San Francisco. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
typescriptrreactsveltekitteamsgdpr
More at Speechmatics
- View →Customer Success ManagerLondon, England, United Kingdom
- View →Director, ProductCambridge, England, United Kingdom
- View →Director, ProductLondon, England, United Kingdom
- View →General ApplicationSpeechmatics UK
- View →Hubspot SpecialistBelgrade, Belgrade, Serbia
- View →Infrastructure Team LeadCambridge, England, United Kingdom