Senior Server Engineer, Central Tech

senior$52K$96K

via Ashby

About this role

[https://app.ashbyhq.com/api/images/user-content/1246dead-d30e-4c70-a1d3-ef7e5023d542/93a4585c-cd0b-4da6-89b4-d52da0f673a8/custom%20programming%20group%20code.jpg] ARE YOU EXCITED TO WORK WITH EVERY SUPERCELL GAME TEAM AND OWN A PIECE OF CRITICAL GAME TECHNOLOGY? ARE YOU READY FOR THE CHALLENGE OF BUILDING A PLATFORM CAPABLE OF HANDLING HUNDREDS OF MILLIONS OF ACTIVE PLAYERS? We are looking for an experienced Senior Server Engineer to join Supercell’s Central Tech organization in Helsinki. As a Senior Server Engineer, you will collaborate closely with all of Supercell’s game teams, developing critical server-side technology that enables reliable, scalable, and efficient game backends and Live Operations (LiveOps).…

Read the full description on Supercell's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: java, shell, sql, aws, gcp…

2

Level fit

This role is senior-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in a specific location. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javashellsqlawsgcpecseksfargateterraformteams

More at Supercell

See all open jobs at Supercell