Senior Data Scientist

San Antonioonsitesenior

Posted 2mo ago · via Workday

About this role

SWBC is seeking a talented individual who will lead the development of our most critical and complex machine learning and AI initiatives. This role is a technical leadership position responsible for setting the strategic direction for data science projects, mentoring the Data Science team, and ensuring our models are scalable, reliable, and directly tied to business outcomes. The Senior Data Scientist will serve as a subject matter expert and strategic partner to business and executive leadership, driving the development and deployment of intelligent solutions across SWBC's enterprise AI/ML platform.…

Read the full description on Swbc's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: python, snowflake, aws, sagemaker, scikit-learn…

2

Level fit

This role is senior-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in San Antonio. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonsnowflakeawssagemakerscikit-learnpytorchtensorflowmlflowbedrockteams

More at Swbc

See all open jobs at Swbc