Frontend Product Engineer
mid$160K – $210K
via Ashby
About this role
About Tacit
We are an early-stage, deep tech startup based in San Francisco, developing innovative hardware that rethinks human-computer interaction. We are backed by General Catalyst, Khosla Ventures, and Greylock Partners, with a founding team from Stanford, BrainGate, Oculus, and Tesla. While we can’t reveal too much just yet, our team is tackling cutting-edge engineering challenges to bring revolutionary products to life.
ABOUT THE ROLE
We are looking for a frontend product engineer to turn early ideas, prototypes, and design explorations into magical user-facing experiences. This is our first dedicated frontend hire: the interfaces you build are how people will actually experience silent speech.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: typescript, swift, react, figma, sketch
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in a specific location. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
typescriptswiftreactfigmasketch
