T
TminetworkHuman Resources

PHP Developer

Hyderabadonsitemid

Posted 127mo ago · via Smartrecruiters

About this role

About TMI is a 25 year old full service HR Consulting firm headquartered in Hyderabad and having presence across all major cities in the country. The group, comprising of three different entities, has about 300 full time employees, and services client requirements across all major economic sectors. You can learn more about the group from http:///tmigroup.in Employment Equity TMI is an equal opportunity employer and employs personnel without regard to race, ancestry, place of origin, colour, ethnic origin, language, citizenship, creed, religion, gender, sexual orientation, age, marital status, physical and/or mental handicap or financial ability. 24 Months Commitment The TMI HR Policies require a 24 months commitment of association from its full time employees.…

Read the full description on Tminetwork's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: javascript, php, html, css, laravel…

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Hyderabad. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascriptphphtmlcsslaravelmysqlmondayxml

More at Tminetwork

See all open jobs at Tminetwork