Senior Software Developer/Analyst, School of Law

UT MAIN CAMPUSonsitesenior

Posted today · via Workday

About this role

Job Posting Title: Senior Software Developer/Analyst, School of Law ---- Hiring Department: School of Law ---- Position Open To: All Applicants ---- Weekly Scheduled Hours: 40 ---- FLSA Status: Exempt from FLSA ---- Earliest Start Date: Immediately ---- Position Duration: Expected to Continue ---- Location: UT MAIN CAMPUS ---- Job Details: General Notes The University of Texas School of Law strives to create and promote an environment that values kindness and mutual respect and a culture that provides a deep sense of belonging for each member of our community.…

Read the full description on Utaustin's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: javascript, php, shell, sql, html…

2

Level fit

This role is senior-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in UT MAIN CAMPUS. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascriptphpshellsqlhtmlcssreactlaravelmysqlgitworkday

More at Utaustin

See all open jobs at Utaustin