Senior Software Developer/Analyst, School of Law
UT MAIN CAMPUSonsitesenior
Posted today · via Workday
About this role
Job Posting Title: Senior Software Developer/Analyst, School of Law ---- Hiring Department: School of Law ---- Position Open To: All Applicants ---- Weekly Scheduled Hours: 40 ---- FLSA Status: Exempt from FLSA ---- Earliest Start Date: Immediately ---- Position Duration: Expected to Continue ---- Location: UT MAIN CAMPUS ---- Job Details: General Notes The University of Texas School of Law strives to create and promote an environment that values kindness and mutual respect and a culture that provides a deep sense of belonging for each member of our community.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: javascript, php, shell, sql, html…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in UT MAIN CAMPUS. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javascriptphpshellsqlhtmlcssreactlaravelmysqlgitworkday
More at Utaustin
- View →Utilities PlumberAUSTIN, TX
- View →Senior Director of Development, Principal Gifts, Corporate & Foundation Relations, College of PharmacyAUSTIN, TX
- View →Director, Executive AffairsUT MAIN CAMPUS
- View →Curator of Modern and Contemporary ArtUT MAIN CAMPUS
- View →Administrative AssociatePORT ARANSAS, TX
- View →Senior Executive Director of Gift and Estate PlanningAUSTIN, TX