Senior, Software Engineer - Python

(USA) Crossman Service Building CA SUNNYVALE Home Officeonsitesenior$117K – $234K

Posted today · via Workday

See if I'm a fit →Tailor my resume for this role →Apply on Workday ↗

About this role

Position Summary... What you'll do... Role summary: As a Senior Software Engineer, you will lead the delivery of scalable, secure software solutions by managing feature development, testing, and ongoing support within collaborative teams. This role requires expertise in multiple programming languages and a strong focus on continuous integration, automation, and AI/ML integration to enhance platform capabilities. You will contribute to technical design, code quality, and operational excellence while mentoring peers and driving innovation. Your work will align with broader business objectives, ensuring reliable, high-performance systems that meet evolving customer and stakeholder needs.…

Read the full description on Walmart's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

Skills match

For this role: python, java, scala, cassandra, gcp…

Level fit

This role is senior-level. We check your trajectory against it.

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

Location fit

This role is based in (USA) Crossman Service Building CA SUNNYVALE Home Office. We weight your proximity and willingness to relocate.

Score yourself on this role.

Free · no card · written explanation included

See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonjavascalacassandragcpgrafanasparkpysparkkafkaairflowteams

More at Walmart

See all open jobs at Walmart →