Senior, Software Engineer - Python
(USA) Crossman Service Building CA SUNNYVALE Home Officeonsitesenior$117K – $234K
Posted today · via Workday
About this role
Position Summary... What you'll do... Role summary: As a Senior Software Engineer, you will lead the delivery of scalable, secure software solutions by managing feature development, testing, and ongoing support within collaborative teams. This role requires expertise in multiple programming languages and a strong focus on continuous integration, automation, and AI/ML integration to enhance platform capabilities. You will contribute to technical design, code quality, and operational excellence while mentoring peers and driving innovation. Your work will align with broader business objectives, ensuring reliable, high-performance systems that meet evolving customer and stakeholder needs.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, java, scala, cassandra, gcp…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in (USA) Crossman Service Building CA SUNNYVALE Home Office. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonjavascalacassandragcpgrafanasparkpysparkkafkaairflowteams
More at Walmart
- View →(USA) Technician, Facility Services, Exterior Services-DOTSalem, IL
- View →(CAN) Produce Stocker(CAN) PE CHARLOTTETOWN 03162 WM SUPERCENTER
- View →(USA) Technician, Facility Services, Exterior Services-DOTBelmont, NC
- View →(USA) Area Manager - Maintenance (Grocery)(USA) MN MANKATO 07079 GROCERY
- View →(CAN) Stock Unloader Associate(CAN) NT YELLOWKNIFE 03121 WAL-MART
- View →(USA) Technician, Facility Services, Exterior ServicesSalem, IL
