(USA) Data Scientist III

(USA) SUNNYVALE TECH CORNERS BLDG 6 CA SUNNYVALE Home Officeonsitemid$117K – $234K

Posted today · via Workday

See if I'm a fit →Tailor my resume for this role →Apply on Workday ↗

About this role

Position Summary... What you'll do... Role summary: The (USA) Data Scientist III plays a critical role in leveraging advanced analytical methods and machine learning techniques to transform complex data into actionable business insights. This position requires expertise in data management, statistical modeling, and scalable model deployment to support strategic decision-making. The role involves collaborating across functions to address business challenges, developing custom analytical solutions, and mentoring team members. A strong understanding of data ecosystems, coding proficiency, and business context is essential to drive innovation and deliver measurable value aligned with organizational goals.…

Read the full description on Walmart's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

Skills match

For this role: python, scala, r, sql, aws…

Level fit

This role is mid-level. We check your trajectory against it.

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

Location fit

This role is based in (USA) SUNNYVALE TECH CORNERS BLDG 6 CA SUNNYVALE Home Office. We weight your proximity and willingness to relocate.

Score yourself on this role.

Free · no card · written explanation included

See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonscalarsqlawssagemakersparktensorflowteams

More at Walmart

See all open jobs at Walmart →