Senior Machine Learning Engineer
CA San Francisco 153 Kearny Streethybridsenior$159K – $296K
Posted today · via Workday
About this role
Welcome to Warner Bros. Discovery… the stuff dreams are made of. Who We Are… When we say, “the stuff dreams are made of,” we’re not just referring to the world of wizards, dragons and superheroes, or even to the wonders of Planet Earth. Behind WBD’s vast portfolio of iconic content and beloved brands, are the storytellers bringing our characters to life, the creators bringing them to your living rooms and the dreamers creating what’s next… From brilliant creatives, to technology trailblazers, across the globe, WBD offers career defining opportunities, thoughtfully curated benefits, and the tools to explore and grow into your best selves. Here you are supported, here you are celebrated, here you can thrive. At HBO Max, storytelling takes center stage.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, scala, sql, snowflake, databricks…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in CA San Francisco 153 Kearny Street. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonscalasqlsnowflakedatabricksawss3lambdasagemakerpysparklangchainmlflowgithubteams
More at Warner Bros
- View →WBD Academic Year Internships (WAY): CNN NYC News - Fall 2026NY New York 30 Hudson Yards
- View →Live Events OperatorVA Sterling 45580 Terminal Drive
- View →WBD Academic Year Internships (WAY): CNN ATL News - Fall 2026GA Atlanta 1050 Techwood Drive NW
- View →WBD Academic Year Internships (WAY): CNN DC News - Fall 2026DC Washington 820 1st Street NE
- View →Editorial Operations Manager, FeaturesNY New York 30 Hudson Yards
- View →Supervising Editor, Health & Wellness - CNN Digital Products & ServicesNY New York 30 Hudson Yards
