Senior Site Reliability Engineer, Wikimedia Enterprise
Remoteremotesenior
via Greenhouse
About this role
Summary
The Wikimedia Foundation is looking for a Senior Site Reliability Engineer to join our team, reporting to the Sr. Engineering Manager. As the Site Reliability Engineer, you will play a key role in designing, developing, and maintaining reliable, scalable, and highly available infrastructure for our API services. You will contribute heavily to the high impact challenges behind innovating, building, and maintaining Wikipedia’s data feeds for high volume reusers. In this role, you will foster cross department collaboration with the wikimedia foundation SRE teams. You will own reliability targets (SLOs) for critical APIs, balancing performance, cost, and availability through data-driven decisions.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, go, aws, azure, gcp…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is remote-eligible — we factor in your stated location and time-zone overlap.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythongoawsazuregcpkinesisiamkubernetesterraformansibleprometheusopentelemetrysparkkafkaflinkgitlabteams