Software Engineer III, Forward Deployed
Rockvilleonsitemid$120K – $145K
Posted 1w ago · via Workday
About this role
X-energy LLC conducts a thorough recruiting process and will never issue offers without interview to discuss qualifications and responsibilities. All applications will be submitted via our company career page, www.x-energy.com/careers/ . We will never ask you to provide payment information as part of the recruiting process. If anyone claiming to represent X-energy directs you in a manner otherwise, please contact us at www.x-energy.com/contact-us . Job Description This role serves as the critical bridge between X-energy's APEX platform development team and stakeholders across the organization. The Forward Deployed Software Engineer is responsible for maximizing APEX platform adoption and effectiveness through direct stakeholder engagement, training, support, and feedback integration.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: typescript, javascript, css, react, tailwind…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Rockville. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
typescriptjavascriptcssreacttailwindvitedynamodbawslambdaecsdockerterraformlangchainclaudebedrockgitgitlabteamsworkday