Full-Stack JavaScript Engineer

Madridhybridmid

Posted 2mo ago · via Recruitee

About this role

Yopeso has been developing a diverse range of software products, from large-scale applications to smaller solutions, for 20 years. With a growing team of over 300 employees across five locations, we are dedicated to fostering a culture of growth, transparency, and professionalism. At Yopeso, we value authenticity, curiosity, and ambition. These values drive us to build strong connections within our community and with our partners, ensuring trust, integrity, and transparency in all our business practices. We strive to maintain the highest professional standards and continuously challenge ourselves to develop high-quality, high-performance, and secure software solutions. Our approach is rooted in efficient collaboration among passionate professionals working in agile teams.…

Read the full description on Yopeso Romania SRL's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: typescript, react, tanstack, tailwindcss, vite…

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Madrid. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

typescriptreacttanstacktailwindcssvitenode.jsexpressrestrestfulwebsocketpostgresqlmongodbredismongoosedockerlangchainopenaianthropicclaudegitjwt

More at Yopeso Romania SRL

See all open jobs at Yopeso Romania SRL