Senior Full Stack Developer (Node.js Focus) – Open-Source AI Platform
Madridhybridsenior
Posted 2mo ago · via Recruitee
About this role
Yopeso has been developing a diverse range of software products, from large-scale applications to smaller solutions, for 20 years. With a growing team of over 300 employees across five locations, we are dedicated to fostering a culture of growth, transparency, and professionalism. At Yopeso, we value authenticity, curiosity, and ambition. These values drive us to build strong connections within our community and with our partners, ensuring trust, integrity, and transparency in all our business practices. We strive to maintain the highest professional standards and continuously challenge ourselves to develop high-quality, high-performance, and secure software solutions. Our approach is rooted in efficient collaboration among passionate professionals working in agile teams.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: typescript, react, tanstack, tailwindcss, vite…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Madrid. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
typescriptreacttanstacktailwindcssvitenode.jsrestrestfulwebsocketpostgresqlmongodbredismongoosedockerlangchainopenaianthropicclaudegitjwt
More at Yopeso Romania SRL
- View →SAP EPPM/PMM ConsultantLondon, United Kingdom
- View →SAP EPPM/PMM ConsultantMadrid, Spain
- View →SAP EPPM/PMM ConsultantBerlin, Germany
- View →SAP EPPM ConsultantRemote, Romania
- View →Senior Cybersecurity Requirements Manager - MoldovaChisinau, Moldova, Republic of
- View →Senior Cybersecurity Requirements ManagerCluj Napoca, Romania
