Lead Software Engineer, Medication Management
Boston MAonsitesenior
Posted today · via Workday
About this role
Join us as we work to create a thriving ecosystem that delivers accessible, high-quality, and sustainable healthcare for all. Lead Software Engineer - Medications Role Summary Join our innovative team as a Lead Software Engineer in Boston, MA, where you will play a pivotal role in shaping the future of medication management. This hybrid position offers the opportunity to lead technical execution for a cross-functional engineering team in delivering high-quality software that enhances healthcare outcomes. You will report to Engineering Manager. Team Summary Our Medication Management engineering team builds mission-critical solutions used by over 170,000 healthcare providers every day.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: javascript, java, html, css, react…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Boston MA. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javascriptjavahtmlcssreactgraphqlsparkteams